Lineage for d3ru6b1 (3ru6 B:1-227)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079824Species Campylobacter jejuni [TaxId:192222] [194783] (4 PDB entries)
  8. 2079826Domain d3ru6b1: 3ru6 B:1-227 [249208]
    Other proteins in same PDB: d3ru6a2, d3ru6b2
    automated match to d3tfxa_
    complexed with cl, iod

Details for d3ru6b1

PDB Entry: 3ru6 (more details), 1.8 Å

PDB Description: 1.8 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase (pyrf) from campylobacter jejuni subsp. jejuni nctc 11168
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3ru6b1:

Sequence, based on SEQRES records: (download)

>d3ru6b1 c.1.2.0 (B:1-227) automated matches {Campylobacter jejuni [TaxId: 192222]}
mklcvaldlstkeeclqlakelknldiwlkvglraylrdgfkfieelkkvddfkifldlk
fhdipntmadaceevsklgvdminihasagkiaiqevmtrlskfskrplvlavsaltsfd
eenffsiyrqkieeavinfskisyengldgmvcsvfeskkikehtssnfltltpgirpfg
etnddqkrvanlamarenlsdyivvgrpiyknenpravcekilnkih

Sequence, based on observed residues (ATOM records): (download)

>d3ru6b1 c.1.2.0 (B:1-227) automated matches {Campylobacter jejuni [TaxId: 192222]}
mklcvaldlstkeeclqlakelknldiwlkvglraylrdgfkfieelkkvddfkifldlk
fhdipntmadaceevsklgvdminihasagkiaiqevmtrlskfskrplvlavsaltsfd
eenffsiyrqkieeavinfskisyengldgmvcsvfeskkikehtssnfltltpgirpfg
etvanlamarenlsdyivvgrpiyknenpravcekilnkih

SCOPe Domain Coordinates for d3ru6b1:

Click to download the PDB-style file with coordinates for d3ru6b1.
(The format of our PDB-style files is described here.)

Timeline for d3ru6b1: