| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
| Family d.129.2.0: automated matches [254315] (1 protein) not a true family |
| Protein automated matches [254722] (4 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [256064] (1 PDB entry) |
| Domain d3rsma4: 3rsm A:368-463 [249206] Other proteins in same PDB: d3rsma1, d3rsma2, d3rsma3 automated match to d1p5dx4 complexed with po4, zn; mutant |
PDB Entry: 3rsm (more details), 2.1 Å
SCOPe Domain Sequences for d3rsma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rsma4 d.129.2.0 (A:368-463) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf
Timeline for d3rsma4: