Lineage for d3rsma4 (3rsm A:368-463)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975468Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2975469Protein automated matches [254722] (4 species)
    not a true protein
  7. 2975499Species Pseudomonas aeruginosa [TaxId:287] [256064] (1 PDB entry)
  8. 2975500Domain d3rsma4: 3rsm A:368-463 [249206]
    Other proteins in same PDB: d3rsma1, d3rsma2, d3rsma3
    automated match to d1p5dx4
    complexed with po4, zn; mutant

Details for d3rsma4

PDB Entry: 3rsm (more details), 2.1 Å

PDB Description: Crystal structure of S108C mutant of PMM/PGM
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3rsma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsma4 d.129.2.0 (A:368-463) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d3rsma4:

Click to download the PDB-style file with coordinates for d3rsma4.
(The format of our PDB-style files is described here.)

Timeline for d3rsma4: