Lineage for d3rsma3 (3rsm A:259-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910221Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2910222Protein automated matches [254721] (4 species)
    not a true protein
  7. 2910306Species Pseudomonas aeruginosa [TaxId:287] [256063] (1 PDB entry)
  8. 2910309Domain d3rsma3: 3rsm A:259-367 [249205]
    Other proteins in same PDB: d3rsma4
    automated match to d1p5dx3
    complexed with po4, zn; mutant

Details for d3rsma3

PDB Entry: 3rsm (more details), 2.1 Å

PDB Description: Crystal structure of S108C mutant of PMM/PGM
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3rsma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsma3 c.84.1.0 (A:259-367) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

SCOPe Domain Coordinates for d3rsma3:

Click to download the PDB-style file with coordinates for d3rsma3.
(The format of our PDB-style files is described here.)

Timeline for d3rsma3: