| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
| Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
| Protein automated matches [254721] (4 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [256063] (1 PDB entry) |
| Domain d3rsma2: 3rsm A:155-258 [249204] Other proteins in same PDB: d3rsma4 automated match to d1p5dx2 complexed with po4, zn; mutant |
PDB Entry: 3rsm (more details), 2.1 Å
SCOPe Domain Sequences for d3rsma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rsma2 c.84.1.0 (A:155-258) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh
pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii
Timeline for d3rsma2: