![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
![]() | Protein automated matches [254721] (4 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [256063] (1 PDB entry) |
![]() | Domain d3rsma1: 3rsm A:12-154 [249203] Other proteins in same PDB: d3rsma4 automated match to d1k2yx1 complexed with po4, zn; mutant |
PDB Entry: 3rsm (more details), 2.1 Å
SCOPe Domain Sequences for d3rsma1:
Sequence, based on SEQRES records: (download)
>d3rsma1 c.84.1.0 (A:12-154) automated matches {Pseudomonas aeruginosa [TaxId: 287]} sifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkqliqg lvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgchnppdyngfkivvagetlaneqi qalreriekndlasgvgsveqvd
>d3rsma1 c.84.1.0 (A:12-154) automated matches {Pseudomonas aeruginosa [TaxId: 287]} sifraltaetaywigraigseslargepcvavgrdgrlsgpelvkqliqglvdcgcqvsd vgmvptpvlyyaanvlegksgvmltgcngfkivvagetlaneqiqalreriekndlasgv gsveqvd
Timeline for d3rsma1: