Lineage for d3rrub_ (3rru B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746326Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1746409Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 1746410Protein automated matches [191137] (2 species)
    not a true protein
  7. 1746411Species Human (Homo sapiens) [TaxId:9606] [189251] (6 PDB entries)
  8. 1746415Domain d3rrub_: 3rru B: [249202]
    automated match to d1elka_

Details for d3rrub_

PDB Entry: 3rru (more details), 3 Å

PDB Description: x-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e
PDB Compounds: (B:) TOM1L1 protein

SCOPe Domain Sequences for d3rrub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rrub_ a.118.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpyatsvghliekatfagvqtedwgqfmhicdiinttqdgpkdavkalkkrisknynhke
iqltlslidmcvqncgpsfqslivkkefvkenlvkllnprynlpldiqnrilnfiktwsq
gfpggvdvsevkevyldlvkk

SCOPe Domain Coordinates for d3rrub_:

Click to download the PDB-style file with coordinates for d3rrub_.
(The format of our PDB-style files is described here.)

Timeline for d3rrub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rrua_