SCOPe 2.08: Domain d3rrub_: 3rru B:

Lineage for d3rrub_ (3rru B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)

8. Domain d3rrub_: 3rru B: [249202]
   automated match to d1elka_

Details for d3rrub_

PDB Entry: 3rru, 3 Å

PDB Description: x-ray crystal structure of the vhs domain of human tom1-like protein, northeast structural genomics consortium target hr3050e

PDB Compounds: (B:) TOM1L1 protein

SCOPe Domain Sequences for d3rrub_:

Sequence; same for both SEQRES and ATOM records:

>d3rrub_ a.118.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpyatsvghliekatfagvqtedwgqfmhicdiinttqdgpkdavkalkkrisknynhke
iqltlslidmcvqncgpsfqslivkkefvkenlvkllnprynlpldiqnrilnfiktwsq
gfpggvdvsevkevyldlvkk

Timeline for d3rrub_:

• d3rrub_ first appeared in SCOPe 2.04
  
• d3rrub_ appears in SCOPe 2.07