SCOPe 2.04: Domain d3rnua1: 3rnu A:572-672

Lineage for d3rnua1 (3rnu A:572-672)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
   Pfam PF02760

6. Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159144] (5 PDB entries)
   Uniprot Q16666 199-301! Uniprot Q16666 302-389

8. Domain d3rnua1: 3rnu A:572-672 [249193]
   automated match to d3rloa1
   protein/DNA complex; complexed with edo, fmt

Details for d3rnua1

PDB Entry: 3rnu, 2.5 Å

PDB Description: Structural Basis of Cytosolic DNA Sensing by Innate Immune Receptors

PDB Compounds: (A:) Gamma-interferon-inducible protein 16

SCOPe Domain Sequences for d3rnua1:

Sequence; same for both SEQRES and ATOM records:

>d3rnua1 b.40.16.1 (A:572-672) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
saqsdlkevmvlnatesfvyepkeqkkmfhatvatenevfrvkvfnidlkekftpkkiia
ianyvcrngflevypftlvadvnadrnmeipkglirsasvt

Timeline for d3rnua1:

• d3rnua1 is new in SCOPe 2.04-stable
  
• d3rnua1 appears in SCOPe 2.05
  
• d3rnua1 appears in the current release, SCOPe 2.08