Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein) Pfam PF02760 |
Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159144] (5 PDB entries) Uniprot Q16666 199-301! Uniprot Q16666 302-389 |
Domain d3rnua1: 3rnu A:572-672 [249193] automated match to d3rloa1 protein/DNA complex; complexed with edo, fmt |
PDB Entry: 3rnu (more details), 2.5 Å
SCOPe Domain Sequences for d3rnua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnua1 b.40.16.1 (A:572-672) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} saqsdlkevmvlnatesfvyepkeqkkmfhatvatenevfrvkvfnidlkekftpkkiia ianyvcrngflevypftlvadvnadrnmeipkglirsasvt
Timeline for d3rnua1: