SCOPe 2.05: Domain d3rnsa2: 3rns A:124-223

Lineage for d3rnsa2 (3rns A:124-223)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (20 species)
   not a true protein

7. Species Leptotrichia buccalis [TaxId:523794] [256062] (1 PDB entry)

8. Domain d3rnsa2: 3rns A:124-223 [249192]
   automated match to d2ozjb_
   complexed with act

Details for d3rnsa2

PDB Entry: 3rns, 2.07 Å

PDB Description: cupin 2 conserved barrel domain protein from leptotrichia buccalis

PDB Compounds: (A:) Cupin 2 conserved barrel domain protein

SCOPe Domain Sequences for d3rnsa2:

Sequence; same for both SEQRES and ATOM records:

>d3rnsa2 b.82.1.0 (A:124-223) automated matches {Leptotrichia buccalis [TaxId: 523794]}
safnlaevveyqegkivsknlvakpnlvmtimsfwkgesldphkapgdalvtvldgegky
yvdgkpfivkkgesavlpaniphaveaetenfkmllilvk

Timeline for d3rnsa2:

• d3rnsa2 first appeared in SCOPe 2.04
  
• d3rnsa2 appears in SCOPe 2.06
  
• d3rnsa2 appears in the current release, SCOPe 2.08