Lineage for d3rmyb1 (3rmy B:862-1067)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780769Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2780798Domain d3rmyb1: 3rmy B:862-1067 [249182]
    Other proteins in same PDB: d3rmya2, d3rmyb2, d3rmyc2, d3rmyd2
    automated match to d3pmea1
    complexed with gol; mutant

Details for d3rmyb1

PDB Entry: 3rmy (more details), 2.3 Å

PDB Description: crystal structure of hcr/d w1238a mutant
PDB Compounds: (B:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3rmyb1:

Sequence, based on SEQRES records: (download)

>d3rmyb1 b.29.1.0 (B:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
vfgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d3rmyb1 b.29.1.0 (B:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
yenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkykslif
dyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfgide
nidenqmlwirdfnifskel

SCOPe Domain Coordinates for d3rmyb1:

Click to download the PDB-style file with coordinates for d3rmyb1.
(The format of our PDB-style files is described here.)

Timeline for d3rmyb1: