Lineage for d3rmxc1 (3rmx C:862-1067)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (54 species)
    not a true protein
  7. 2375214Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2375249Domain d3rmxc1: 3rmx C:862-1067 [249176]
    Other proteins in same PDB: d3rmxa2, d3rmxb2, d3rmxc2, d3rmxd2
    automated match to d3pmea1
    mutant

Details for d3rmxc1

PDB Entry: 3rmx (more details), 2.75 Å

PDB Description: Crystal structure of HCR/D F1240A mutant
PDB Compounds: (C:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3rmxc1:

Sequence, based on SEQRES records: (download)

>d3rmxc1 b.29.1.0 (C:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
vfgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d3rmxc1 b.29.1.0 (C:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
inssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkykslifd
yseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfgiden
idenqmlwirdfnifskel

SCOPe Domain Coordinates for d3rmxc1:

Click to download the PDB-style file with coordinates for d3rmxc1.
(The format of our PDB-style files is described here.)

Timeline for d3rmxc1: