Lineage for d3rmdd2 (3rmd D:376-897)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622168Protein Family B DNA polymerase [56680] (7 species)
  7. 2622169Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 2622296Domain d3rmdd2: 3rmd D:376-897 [249171]
    Other proteins in same PDB: d3rmda1, d3rmdb1, d3rmdc1, d3rmdd1
    automated match to d3l8bb2
    protein/DNA complex; complexed with dtp

Details for d3rmdd2

PDB Entry: 3rmd (more details), 2.98 Å

PDB Description: crystal structure of a replicative dna polymerase bound to dna containing thymine glycol
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d3rmdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rmdd2 e.8.1.1 (D:376-897) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkasl

SCOPe Domain Coordinates for d3rmdd2:

Click to download the PDB-style file with coordinates for d3rmdd2.
(The format of our PDB-style files is described here.)

Timeline for d3rmdd2: