SCOPe 2.05: Domain d1ltaf_: 1lta F:

Lineage for d1ltaf_ (1lta F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)

8. Domain d1ltaf_: 1lta F: [24917]
   Other proteins in same PDB: d1lta.1
   complexed with gal

Details for d1ltaf_

PDB Entry: 1lta, 2.2 Å

PDB Description: 2.2 angstroms crystal structure of e. coli heat-labile enterotoxin (lt) with bound galactose

PDB Compounds: (F:) heat-labile enterotoxin, subunit b

SCOPe Domain Sequences for d1ltaf_:

Sequence; same for both SEQRES and ATOM records:

>d1ltaf_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1ltaf_:

• d1ltaf_ first appeared (with stable ids) in SCOP 1.55
  
• d1ltaf_ appears in SCOPe 2.04
  
• d1ltaf_ appears in SCOPe 2.06
  
• d1ltaf_ appears in the current release, SCOPe 2.08