Lineage for d3rmdc2 (3rmd C:376-901)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1692264Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1692356Protein Family B DNA polymerase [56680] (7 species)
  7. 1692357Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries)
  8. 1692460Domain d3rmdc2: 3rmd C:376-901 [249169]
    Other proteins in same PDB: d3rmda1, d3rmdb1, d3rmdc1, d3rmdd1
    automated match to d3l8bb2
    protein/DNA complex; complexed with dtp

Details for d3rmdc2

PDB Entry: 3rmd (more details), 2.98 Å

PDB Description: crystal structure of a replicative dna polymerase bound to dna containing thymine glycol
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d3rmdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rmdc2 e.8.1.1 (C:376-901) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmf

SCOPe Domain Coordinates for d3rmdc2:

Click to download the PDB-style file with coordinates for d3rmdc2.
(The format of our PDB-style files is described here.)

Timeline for d3rmdc2: