![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (38 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
![]() | Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
![]() | Protein automated matches [254664] (2 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries) |
![]() | Domain d3rk2f1: 3rk2 F:191-248 [249135] Other proteins in same PDB: d3rk2b2, d3rk2c1, d3rk2c2, d3rk2d1, d3rk2d2, d3rk2f2, d3rk2g1, d3rk2g2, d3rk2h1, d3rk2h2 automated match to d1n7sb_ complexed with ca |
PDB Entry: 3rk2 (more details), 2.2 Å
SCOPe Domain Sequences for d3rk2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rk2f1 h.1.15.1 (F:191-248) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
Timeline for d3rk2f1: