SCOPe 2.07: Domain d3rk2b1: 3rk2 B:191-248

Lineage for d3rk2b1 (3rk2 B:191-248)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein automated matches [254664] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries)

8. Domain d3rk2b1: 3rk2 B:191-248 [249132]
   Other proteins in same PDB: d3rk2b2, d3rk2c1, d3rk2c2, d3rk2d1, d3rk2d2, d3rk2f2, d3rk2g1, d3rk2g2, d3rk2h1, d3rk2h2
   automated match to d1n7sb_
   complexed with ca

Details for d3rk2b1

PDB Entry: 3rk2, 2.2 Å

PDB Description: Truncated SNARE complex

PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d3rk2b1:

Sequence; same for both SEQRES and ATOM records:

>d3rk2b1 h.1.15.1 (B:191-248) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav

Timeline for d3rk2b1:

• d3rk2b1 first appeared in SCOPe 2.04, called d3rk2b_
  
• d3rk2b1 appears in SCOPe 2.06
  
• d3rk2b1 appears in the current release, SCOPe 2.08