Lineage for d3rk2b1 (3rk2 B:191-248)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266412Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2266413Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2266511Protein automated matches [254664] (2 species)
    not a true protein
  7. 2266516Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (4 PDB entries)
  8. 2266517Domain d3rk2b1: 3rk2 B:191-248 [249132]
    Other proteins in same PDB: d3rk2b2, d3rk2c1, d3rk2c2, d3rk2d1, d3rk2d2, d3rk2f2, d3rk2g1, d3rk2g2, d3rk2h1, d3rk2h2
    automated match to d1n7sb_
    complexed with ca

Details for d3rk2b1

PDB Entry: 3rk2 (more details), 2.2 Å

PDB Description: Truncated SNARE complex
PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d3rk2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rk2b1 h.1.15.1 (B:191-248) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav

SCOPe Domain Coordinates for d3rk2b1:

Click to download the PDB-style file with coordinates for d3rk2b1.
(The format of our PDB-style files is described here.)

Timeline for d3rk2b1: