Lineage for d3rjtb1 (3rjt B:1-213)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857508Species Alicyclobacillus acidocaldarius [TaxId:521098] [256058] (1 PDB entry)
  8. 2857510Domain d3rjtb1: 3rjt B:1-213 [249129]
    Other proteins in same PDB: d3rjta2, d3rjtb2
    automated match to d4jhla_
    complexed with act, cl, edo, so4

Details for d3rjtb1

PDB Entry: 3rjt (more details), 1.5 Å

PDB Description: Crystal structure of lipolytic protein G-D-S-L family from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
PDB Compounds: (B:) Lipolytic protein G-D-S-L family

SCOPe Domain Sequences for d3rjtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjtb1 c.23.10.0 (B:1-213) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
miepgsklvmvgdsitdcgrahpvgeaprgglgngyvalvdahlqvlhpdwrirvvnvgt
sgntvadvarrweddvmalqpdyvslmigvndvwrqfdmplvverhvgideyrdtlrhlv
attkprvremfllspfylepnrsdpmrktvdayieamrdvaasehvpfvdvqaefdrlla
hlntwvlapdrvhpylnghlviarafltavgvl

SCOPe Domain Coordinates for d3rjtb1:

Click to download the PDB-style file with coordinates for d3rjtb1.
(The format of our PDB-style files is described here.)

Timeline for d3rjtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rjtb2