SCOPe 2.08: Domain d3rjta1: 3rjt A:1-213

Lineage for d3rjta1 (3rjt A:1-213)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (16 species)
   not a true protein

7. Species Alicyclobacillus acidocaldarius [TaxId:521098] [256058] (1 PDB entry)

8. Domain d3rjta1: 3rjt A:1-213 [249128]
   Other proteins in same PDB: d3rjta2, d3rjtb2
   automated match to d4jhla_
   complexed with act, cl, edo, so4

Details for d3rjta1

PDB Entry: 3rjt, 1.5 Å

PDB Description: Crystal structure of lipolytic protein G-D-S-L family from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

PDB Compounds: (A:) Lipolytic protein G-D-S-L family

SCOPe Domain Sequences for d3rjta1:

Sequence; same for both SEQRES and ATOM records:

>d3rjta1 c.23.10.0 (A:1-213) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
miepgsklvmvgdsitdcgrahpvgeaprgglgngyvalvdahlqvlhpdwrirvvnvgt
sgntvadvarrweddvmalqpdyvslmigvndvwrqfdmplvverhvgideyrdtlrhlv
attkprvremfllspfylepnrsdpmrktvdayieamrdvaasehvpfvdvqaefdrlla
hlntwvlapdrvhpylnghlviarafltavgvl

Timeline for d3rjta1:

• d3rjta1 first appeared in SCOPe 2.04, called d3rjta_
  
• d3rjta1 appears in SCOPe 2.07