SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ri4a_ (3ri4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982648Family a.4.5.21: ets domain [46859] (9 protein domains)
  6. 1982694Protein automated matches [191121] (2 species)
    not a true protein
  7. 1982695Species Human (Homo sapiens) [TaxId:9606] [193283] (14 PDB entries)
  8. 1982715Domain d3ri4a_: 3ri4 A: [249124]
    automated match to d1gvjb_
    protein/DNA complex

Details for d3ri4a_

PDB Entry: 3ri4 (more details), 3 Å

PDB Description: ets1 cooperative binding to widely separated sites on promoter dna
PDB Compounds: (A:) Protein C-ets-1

SCOPe Domain Sequences for d3ri4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ri4a_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgw
efklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsl
lgytpeelhamldvkp

SCOPe Domain Coordinates for d3ri4a_:

Click to download the PDB-style file with coordinates for d3ri4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ri4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ri4d_