Lineage for d3rhrd_ (3rhr D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621931Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1621932Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1622321Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1622322Protein automated matches [190683] (35 species)
    not a true protein
  7. 1622505Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries)
  8. 1622533Domain d3rhrd_: 3rhr D: [249123]
    automated match to d1bxsa_
    complexed with gol, ndp, so4; mutant

Details for d3rhrd_

PDB Entry: 3rhr (more details), 2.3 Å

PDB Description: crystal structure of the c707a mutant of the c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with nadph
PDB Compounds: (D:) Aldehyde dehydrogenase 1 family, member L1

SCOPe Domain Sequences for d3rhrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhrd_ c.82.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
kigftgstevgkhimkscalsnvkkvslelggkspliifadcdlnkavqmgmssvffnkg
enaiaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
geaalneylriktvtfey

SCOPe Domain Coordinates for d3rhrd_:

Click to download the PDB-style file with coordinates for d3rhrd_.
(The format of our PDB-style files is described here.)

Timeline for d3rhrd_: