Lineage for d3rhob_ (3rho B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909496Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries)
  8. 2909510Domain d3rhob_: 3rho B: [249109]
    automated match to d1bxsa_
    complexed with gol, nap, so4; mutant

Details for d3rhob_

PDB Entry: 3rho (more details), 2.26 Å

PDB Description: crystal structure of the e673q mutant of c-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with nadp
PDB Compounds: (B:) Aldehyde dehydrogenase 1 family, member L1

SCOPe Domain Sequences for d3rhob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhob_ c.82.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka
vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg
msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt
aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr
kigftgstevgkhimkscalsnvkkvslqlggkspliifadcdlnkavqmgmssvffnkg
enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr
gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl
sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl
geaalneylriktvtfey

SCOPe Domain Coordinates for d3rhob_:

Click to download the PDB-style file with coordinates for d3rhob_.
(The format of our PDB-style files is described here.)

Timeline for d3rhob_: