Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (38 species) not a true protein |
Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries) |
Domain d3rhhc_: 3rhh C: [249094] automated match to d4o6rb_ complexed with nap, so4 |
PDB Entry: 3rhh (more details), 2.3 Å
SCOPe Domain Sequences for d3rhhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rhhc_ c.82.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 86665]} eqfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwki rpihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrl ngetlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkp atqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeri sekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvad qlvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnl lsptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrai nigkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl
Timeline for d3rhhc_: