Lineage for d3rhha_ (3rhh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909081Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries)
  8. 2909089Domain d3rhha_: 3rhh A: [249092]
    Other proteins in same PDB: d3rhhb2, d3rhhd2
    automated match to d4o6rb_
    complexed with nap, so4

Details for d3rhha_

PDB Entry: 3rhh (more details), 2.3 Å

PDB Description: Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from Bacillus halodurans C-125 complexed with NADP
PDB Compounds: (A:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3rhha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhha_ c.82.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl

SCOPe Domain Coordinates for d3rhha_:

Click to download the PDB-style file with coordinates for d3rhha_.
(The format of our PDB-style files is described here.)

Timeline for d3rhha_: