SCOPe 2.08: Domain d3rhha_: 3rhh A:

Lineage for d3rhha_ (3rhh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (61 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries)

8. Domain d3rhha_: 3rhh A: [249092]
   Other proteins in same PDB: d3rhhb2, d3rhhd2
   automated match to d4o6rb_
   complexed with nap, so4

Details for d3rhha_

PDB Entry: 3rhh, 2.3 Å

PDB Description: Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from Bacillus halodurans C-125 complexed with NADP

PDB Compounds: (A:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3rhha_:

Sequence; same for both SEQRES and ATOM records:

>d3rhha_ c.82.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 86665]}
qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl

Timeline for d3rhha_:

• d3rhha_ first appeared in SCOPe 2.04
  
• d3rhha_ appears in SCOPe 2.07