Lineage for d1lt4h_ (1lt4 H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667490Protein Heat-labile toxin [50205] (2 species)
  7. 667491Species Escherichia coli, type IB [TaxId:562] [50206] (19 PDB entries)
  8. 667546Domain d1lt4h_: 1lt4 H: [24909]
    Other proteins in same PDB: d1lt4a_
    complexed with gal, glc; mutant

Details for d1lt4h_

PDB Entry: 1lt4 (more details), 2 Å

PDB Description: heat-labile enterotoxin mutant s63k
PDB Compounds: (H:) heat-labile enterotoxin

SCOP Domain Sequences for d1lt4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt4h_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1lt4h_:

Click to download the PDB-style file with coordinates for d1lt4h_.
(The format of our PDB-style files is described here.)

Timeline for d1lt4h_: