Lineage for d3rf1b_ (3rf1 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920896Protein automated matches [193659] (5 species)
    not a true protein
  7. 1920902Species Campylobacter jejuni [TaxId:354242] [256055] (1 PDB entry)
  8. 1920904Domain d3rf1b_: 3rf1 B: [249083]
    automated match to d1j5wa_
    complexed with gol, lmr

Details for d3rf1b_

PDB Entry: 3rf1 (more details), 2.2 Å

PDB Description: The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
PDB Compounds: (B:) Glycyl-tRNA synthetase alpha subunit

SCOPe Domain Sequences for d3rf1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rf1b_ d.104.1.1 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
amtfsqmilnlqnywqeqgcaimqpydmpagagtfhpatflrslgkkpwaaayvapsrrp
tdgrygenpnrlgayyqfqvlikpspdniqelylkslenlgfdlkshdirfvednwesps
lgawglgwevwldgmevtqftyfqqvggiavdlvsaeitygleriamylqnvdnvydivw
sefngekikyadvhkqseyefskynfevsdvkilneqfensykecknileqglalpaydy
cmlaahtfnlldargaisvaqrqdymlkirelskncaeiykknln

SCOPe Domain Coordinates for d3rf1b_:

Click to download the PDB-style file with coordinates for d3rf1b_.
(The format of our PDB-style files is described here.)

Timeline for d3rf1b_: