SCOPe 2.08: Domain d3r9fa_: 3r9f A:

Lineage for d3r9fa_ (3r9f A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233422] (5 PDB entries)

8. Domain d3r9fa_: 3r9f A: [249075]
   automated match to d3r95a_
   complexed with coa, gsu

Details for d3r9fa_

PDB Entry: 3r9f, 1.2 Å

PDB Description: crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and glutamyl sulfamoyl adenosine (esa)

PDB Compounds: (A:) MccE protein

SCOPe Domain Sequences for d3r9fa_:

Sequence; same for both SEQRES and ATOM records:

>d3r9fa_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
dvsltpsgikvndeitllypalkyaeelyllinqnkinfiksmawpafvnnisdsvsfie
qsmidnqnekalilfikyktkiagvvsfniidhanktayigywlganfqgkgivtnaink
liqeygdsgvikrfvikcivdnkksnatalrcgftlegvlqkaeilngvsydqniyskvi

Timeline for d3r9fa_:

• d3r9fa_ first appeared in SCOPe 2.04
  
• d3r9fa_ appears in SCOPe 2.07