Lineage for d1lt4f_ (1lt4 F:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Heat-labile toxin [50205] (2 species) Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries) 
Domain d1lt4f_: 1lt4 F: [24907]
Other proteins in same PDB: d1lt4a_
Details for d1lt4f_
PDB Entry: 1lt4 (more details), 2 Å
PDB Description: heat-labile enterotoxin mutant s63k
SCOP Domain Sequences for d1lt4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lt4f_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
SCOP Domain Coordinates for d1lt4f_:
Click to download the PDB-style file with coordinates for d1lt4f_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lt4f_:
- d1lt4f_ appears in SCOP 1.57
- d1lt4f_ appears in the current release, SCOPe 2.08
View in 3D
