| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
| Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
| Protein automated matches [190072] (22 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256054] (2 PDB entries) |
| Domain d3r8wc_: 3r8w C: [249069] automated match to d3u1ha_ complexed with act |
PDB Entry: 3r8w (more details), 2.25 Å
SCOPe Domain Sequences for d3r8wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8wc_ c.77.1.1 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvd
Timeline for d3r8wc_: