Lineage for d3r8wc_ (3r8w C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513401Protein automated matches [190072] (22 species)
    not a true protein
  7. 2513527Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256054] (2 PDB entries)
  8. 2513530Domain d3r8wc_: 3r8w C: [249069]
    automated match to d3u1ha_
    complexed with act

Details for d3r8wc_

PDB Entry: 3r8w (more details), 2.25 Å

PDB Description: Structure of 3-isopropylmalate dehydrogenase isoform 2 from Arabidopsis thaliana at 2.2 angstrom resolution
PDB Compounds: (C:) 3-isopropylmalate dehydrogenase 2, chloroplastic

SCOPe Domain Sequences for d3r8wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8wc_ c.77.1.1 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvd

SCOPe Domain Coordinates for d3r8wc_:

Click to download the PDB-style file with coordinates for d3r8wc_.
(The format of our PDB-style files is described here.)

Timeline for d3r8wc_: