SCOPe 2.05: Domain d3r8qa1: 3r8q A:1-92

Lineage for d3r8qa1 (3r8q A:1-92)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d3r8qa1: 3r8q A:1-92 [249064]
   automated match to d1fnfa2

Details for d3r8qa1

PDB Entry: 3r8q, 2.4 Å

PDB Description: Structure of Fibronectin domain 12-14

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d3r8qa1:

Sequence; same for both SEQRES and ATOM records:

>d3r8qa1 b.1.2.0 (A:1-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aipaptdlkftqvtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvs
glmvatkyevsvyalkdtltsrpaqgvvttle

Timeline for d3r8qa1:

• d3r8qa1 first appeared in SCOPe 2.04
  
• d3r8qa1 appears in SCOPe 2.06
  
• d3r8qa1 appears in the current release, SCOPe 2.08