![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
![]() | Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) ![]() |
![]() | Family d.60.1.0: automated matches [254313] (1 protein) not a true family |
![]() | Protein automated matches [254719] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256053] (3 PDB entries) |
![]() | Domain d3r8kd_: 3r8k D: [249063] automated match to d2gova1 |
PDB Entry: 3r8k (more details), 2.85 Å
SCOPe Domain Sequences for d3r8kd_:
Sequence, based on SEQRES records: (download)
>d3r8kd_ d.60.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgkne kemkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvf vrsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqkn
>d3r8kd_ d.60.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avetpgwkapegsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknekemkik mtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfvrsfdg fssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqkn
Timeline for d3r8kd_: