Lineage for d1lt4e_ (1lt4 E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 798869Protein Heat-labile toxin [50205] (2 species)
  7. 798870Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries)
  8. 798922Domain d1lt4e_: 1lt4 E: [24906]
    Other proteins in same PDB: d1lt4a_

Details for d1lt4e_

PDB Entry: 1lt4 (more details), 2 Å

PDB Description: heat-labile enterotoxin mutant s63k
PDB Compounds: (E:) heat-labile enterotoxin

SCOP Domain Sequences for d1lt4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lt4e_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1lt4e_:

Click to download the PDB-style file with coordinates for d1lt4e_.
(The format of our PDB-style files is described here.)

Timeline for d1lt4e_: