SCOPe 2.08: Domain d3r8jb_: 3r8j B:

Lineage for d3r8jb_ (3r8j B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
   duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)

4. Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families)

5. Family d.60.1.0: automated matches [254313] (1 protein)
   not a true family

6. Protein automated matches [254719] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256053] (3 PDB entries)

8. Domain d3r8jb_: 3r8j B: [249059]
   automated match to d2gova1
   complexed with po4

Details for d3r8jb_

PDB Entry: 3r8j, 1.6 Å

PDB Description: Crystal structure of human SOUL protein (orthorhombic form)

PDB Compounds: (B:) Heme-binding protein 2

SCOPe Domain Sequences for d3r8jb_:

Sequence; same for both SEQRES and ATOM records:

>d3r8jb_ d.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgkne
kemkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvf
vrsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqkn

Timeline for d3r8jb_:

• d3r8jb_ first appeared in SCOPe 2.04
  
• d3r8jb_ appears in SCOPe 2.07