| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Vibrio parahaemolyticus [TaxId:670] [256052] (1 PDB entry) |
| Domain d3r6mc2: 3r6m C:109-213 [249055] automated match to d2gema2 |
PDB Entry: 3r6m (more details), 3.1 Å
SCOPe Domain Sequences for d3r6mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r6mc2 c.55.1.0 (C:109-213) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
atdvavaidarmsevywarysrqengewigvdeecvipparlaeeaqadsktwttagtgw
sayqeelaglpfntadsevlypdsqdivilakqelekgntvpvee
Timeline for d3r6mc2: