SCOPe 2.05: Domain d3r4da2: 3r4d A:108-199

Lineage for d3r4da2 (3r4d A:108-199)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [256051] (1 PDB entry)

8. Domain d3r4da2: 3r4d A:108-199 [249047]
   Other proteins in same PDB: d3r4da1, d3r4dc1
   automated match to d1l6za2
   complexed with nag

Details for d3r4da2

PDB Entry: 3r4d, 3.1 Å

PDB Description: crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor

PDB Compounds: (A:) CEA-related cell adhesion molecule 1, isoform 1/2S

SCOPe Domain Sequences for d3r4da2:

Sequence; same for both SEQRES and ATOM records:

>d3r4da2 b.1.1.4 (A:108-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri
dpikredageyqceisnpvsvrrsnsikldii

Timeline for d3r4da2:

• d3r4da2 first appeared in SCOPe 2.04
  
• d3r4da2 appears in SCOPe 2.06
  
• d3r4da2 appears in the current release, SCOPe 2.07