SCOPe 2.08: Domain d3r4da1: 3r4d A:1-107

Lineage for d3r4da1 (3r4d A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3r4da1: 3r4d A:1-107 [249046]
   Other proteins in same PDB: d3r4da2, d3r4db_, d3r4dc2, d3r4dd_
   automated match to d1l6za1
   complexed with nag

Details for d3r4da1

PDB Entry: 3r4d, 3.1 Å

PDB Description: crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor

PDB Compounds: (A:) CEA-related cell adhesion molecule 1, isoform 1/2S

SCOPe Domain Sequences for d3r4da1:

Sequence; same for both SEQRES and ATOM records:

>d3r4da1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvh

Timeline for d3r4da1:

• d3r4da1 first appeared in SCOPe 2.04
  
• d3r4da1 appears in SCOPe 2.07