Lineage for d3r3sd_ (3r3s D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581457Species Salmonella enterica [TaxId:90371] [256050] (1 PDB entry)
  8. 1581461Domain d3r3sd_: 3r3s D: [249045]
    automated match to d3ijrb_
    complexed with fmt, mg, nad, so4

Details for d3r3sd_

PDB Entry: 3r3s (more details), 1.25 Å

PDB Description: Structure of the YghA Oxidoreductase from Salmonella enterica
PDB Compounds: (D:) Oxidoreductase

SCOPe Domain Sequences for d3r3sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3sd_ c.2.1.0 (D:) automated matches {Salmonella enterica [TaxId: 90371]}
hlydpttqyytgeypkqkqpapgvqakmtpvpdcgeksyvgsgrlkdrkalvtggdsgig
raaaiayaregadvainylpaeeedaqqvkalieecgrkavllpgdlsdesfarslvhka
realggldilalvagkqtaipeikdltseqfqqtfavnvfalfwitqeaipllpkgasii
ttssiqayqpsphlldyaatkaailnysrglakqvaekgirvnivapgpiwtalqisggq
tqdkipqfgqqtpmkragqpaelapvyvylasqessyvtaevhgvcggehlg

SCOPe Domain Coordinates for d3r3sd_:

Click to download the PDB-style file with coordinates for d3r3sd_.
(The format of our PDB-style files is described here.)

Timeline for d3r3sd_: