| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Salmonella enterica [TaxId:90371] [256050] (1 PDB entry) |
| Domain d3r3sb_: 3r3s B: [249043] automated match to d3ijrb_ complexed with fmt, mg, nad, so4 |
PDB Entry: 3r3s (more details), 1.25 Å
SCOPe Domain Sequences for d3r3sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3sb_ c.2.1.0 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
hlydpttqyytgeypkqkqpapgvqakmtpvpdcgeksyvgsgrlkdrkalvtggdsgig
raaaiayaregadvainylpaeeedaqqvkalieecgrkavllpgdlsdesfarslvhka
realggldilalvagkqtaipeikdltseqfqqtfavnvfalfwitqeaipllpkgasii
ttssiqayqpsphlldyaatkaailnysrglakqvaekgirvnivapgpiwtalqisggq
tqdkipqfgqqtpmkragqpaelapvyvylasqessyvtaevhgvcggehlg
Timeline for d3r3sb_: