SCOPe 2.05: Domain d3r3sa_: 3r3s A:

Lineage for d3r3sa_ (3r3s A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [256050] (1 PDB entry)

8. Domain d3r3sa_: 3r3s A: [249042]
   automated match to d3ijrb_
   complexed with fmt, mg, nad, so4

Details for d3r3sa_

PDB Entry: 3r3s, 1.25 Å

PDB Description: Structure of the YghA Oxidoreductase from Salmonella enterica

PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d3r3sa_:

Sequence; same for both SEQRES and ATOM records:

>d3r3sa_ c.2.1.0 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
hlydpttqyytgeypkqkqpapgvqakmtpvpdcgeksyvgsgrlkdrkalvtggdsgig
raaaiayaregadvainylpaeeedaqqvkalieecgrkavllpgdlsdesfarslvhka
realggldilalvagkqtaipeikdltseqfqqtfavnvfalfwitqeaipllpkgasii
ttssiqayqpsphlldyaatkaailnysrglakqvaekgirvnivapgpiwtalqisggq
tqdkipqfgqqtpmkragqpaelapvyvylasqessyvtaevhgvcggehlg

Timeline for d3r3sa_:

• d3r3sa_ first appeared in SCOPe 2.04
  
• d3r3sa_ appears in SCOPe 2.06
  
• d3r3sa_ appears in the current release, SCOPe 2.08