SCOPe 2.06: Domain d3r3mb_: 3r3m B:

Lineage for d3r3mb_ (3r3m B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.2: UBX domain [54250] (6 proteins)
   Pfam PF00789

6. Protein automated matches [191298] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)

8. Domain d3r3mb_: 3r3m B: [249039]
   Other proteins in same PDB: d3r3md2
   automated match to d2cr5a1
   complexed with po4

Details for d3r3mb_

PDB Entry: 3r3m, 3 Å

PDB Description: crystal structure of the faf1 ubx domain

PDB Compounds: (B:) fas-associated factor 1

SCOPe Domain Sequences for d3r3mb_:

Sequence; same for both SEQRES and ATOM records:

>d3r3mb_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enaepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtql
dpnksllevklfpqetlfleak

Timeline for d3r3mb_:

• d3r3mb_ first appeared in SCOPe 2.04
  
• d3r3mb_ appears in SCOPe 2.05
  
• d3r3mb_ appears in SCOPe 2.07
  
• d3r3mb_ appears in the current release, SCOPe 2.08