Lineage for d3r3ma_ (3r3m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932685Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2932705Protein automated matches [191298] (1 species)
    not a true protein
  7. 2932706Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)
  8. 2932716Domain d3r3ma_: 3r3m A: [249038]
    Other proteins in same PDB: d3r3md2
    automated match to d2cr5a1
    complexed with po4

Details for d3r3ma_

PDB Entry: 3r3m (more details), 3 Å

PDB Description: crystal structure of the faf1 ubx domain
PDB Compounds: (A:) fas-associated factor 1

SCOPe Domain Sequences for d3r3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3ma_ d.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msenaepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvt
qldpnksllevklfpqetlfleak

SCOPe Domain Coordinates for d3r3ma_:

Click to download the PDB-style file with coordinates for d3r3ma_.
(The format of our PDB-style files is described here.)

Timeline for d3r3ma_: