Lineage for d3r3jb1 (3r3j B:55-257)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610413Species Plasmodium falciparum [TaxId:36329] [256049] (1 PDB entry)
  8. 1610415Domain d3r3jb1: 3r3j B:55-257 [249028]
    Other proteins in same PDB: d3r3ja2, d3r3jb2, d3r3jc2, d3r3jd2, d3r3je2, d3r3jf2
    automated match to d1bgva2

Details for d3r3jb1

PDB Entry: 3r3j (more details), 3.1 Å

PDB Description: Kinetic and structural characterization of Plasmodium falciparum glutamate dehydrogenase 2
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d3r3jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3jb1 c.58.1.0 (B:55-257) automated matches {Plasmodium falciparum [TaxId: 36329]}
lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
reigylfgqykklknsfegvltg

SCOPe Domain Coordinates for d3r3jb1:

Click to download the PDB-style file with coordinates for d3r3jb1.
(The format of our PDB-style files is described here.)

Timeline for d3r3jb1: