Lineage for d3r2ya_ (3r2y A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673283Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 1673284Species Human (Homo sapiens) [TaxId:9606] [82790] (14 PDB entries)
  8. 1673331Domain d3r2ya_: 3r2y A: [249024]
    automated match to d3ka0a_
    complexed with mli, p4o

Details for d3r2ya_

PDB Entry: 3r2y (more details), 3 Å

PDB Description: MK2 kinase bound to Compound 1
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3r2ya_:

Sequence, based on SEQRES records: (download)

>d3r2ya_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterease
imksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcy
tpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqye
fpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked

Sequence, based on observed residues (ATOM records): (download)

>d3r2ya_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdtereaseimksig
eaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettdkscdmwslgvimyil
lcgyppfymktrirmgqyefpnpewsevseevkmlirnllkteptqrmtitefmnhpwim
qstkvpqtplhtsrvlked

SCOPe Domain Coordinates for d3r2ya_:

Click to download the PDB-style file with coordinates for d3r2ya_.
(The format of our PDB-style files is described here.)

Timeline for d3r2ya_: