| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
| Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
| Protein automated matches [190499] (26 species) not a true protein |
| Species Leishmania infantum [TaxId:5671] [256047] (1 PDB entry) |
| Domain d3r2jc_: 3r2j C: [249022] Other proteins in same PDB: d3r2jb2 automated match to d3hu5a_ complexed with cl, nio, zn |
PDB Entry: 3r2j (more details), 2.68 Å
SCOPe Domain Sequences for d3r2jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r2jc_ c.33.1.0 (C:) automated matches {Leishmania infantum [TaxId: 5671]}
lcvtvssttdvliiadmqvdflapggslhvkggealldginavssqlpfryqvatqdwhp
enhcsfvthggpwpphcvqgsagaqlhaglhtqrinavirkgvtqqadsysafvedngvs
tglagllhsigarrvfvcgvaydfcvfftamdarkngfsvvlledltaavddaawsarta
elkdagvvllkssalvae
Timeline for d3r2jc_:
View in 3DDomains from other chains: (mouse over for more information) d3r2ja_, d3r2jb1, d3r2jb2, d3r2jd_ |