Lineage for d3r2jc_ (3r2j C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864275Species Leishmania infantum [TaxId:5671] [256047] (1 PDB entry)
  8. 2864278Domain d3r2jc_: 3r2j C: [249022]
    Other proteins in same PDB: d3r2jb2
    automated match to d3hu5a_
    complexed with cl, nio, zn

Details for d3r2jc_

PDB Entry: 3r2j (more details), 2.68 Å

PDB Description: Crystal Structure of PnC1 from L. infantum in complex with nicotinate
PDB Compounds: (C:) Alpha/beta-hydrolase-like protein

SCOPe Domain Sequences for d3r2jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2jc_ c.33.1.0 (C:) automated matches {Leishmania infantum [TaxId: 5671]}
lcvtvssttdvliiadmqvdflapggslhvkggealldginavssqlpfryqvatqdwhp
enhcsfvthggpwpphcvqgsagaqlhaglhtqrinavirkgvtqqadsysafvedngvs
tglagllhsigarrvfvcgvaydfcvfftamdarkngfsvvlledltaavddaawsarta
elkdagvvllkssalvae

SCOPe Domain Coordinates for d3r2jc_:

Click to download the PDB-style file with coordinates for d3r2jc_.
(The format of our PDB-style files is described here.)

Timeline for d3r2jc_: