SCOPe 2.07: Domain d3r24b1: 3r24 B:10-129

Lineage for d3r24b1 (3r24 B:10-129)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
   binds two zinc ion per subunit; forms a dodecameric shell

4. Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family)
   automatically mapped to Pfam PF09401

5. Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
   partly covered by PfamB PB001266

6. Protein automated matches [191249] (4 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries)

8. Domain d3r24b1: 3r24 B:10-129 [249019]
   Other proteins in same PDB: d3r24b2
   automated match to d2xyqb_
   complexed with sam, zn

Details for d3r24b1

PDB Entry: 3r24, 2 Å

PDB Description: crystal structure of nsp10/nsp16 complex of sars coronavirus

PDB Compounds: (B:) Non-structural protein 10 and Non-structural protein 11

SCOPe Domain Sequences for d3r24b1:

Sequence; same for both SEQRES and ATOM records:

>d3r24b1 g.86.1.1 (B:10-129) automated matches {SARS coronavirus [TaxId: 227859]}
nstvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfg
gascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcs

Timeline for d3r24b1:

• d3r24b1 first appeared in SCOPe 2.04, called d3r24b_
  
• d3r24b1 appears in SCOPe 2.06
  
• d3r24b1 appears in the current release, SCOPe 2.08