Lineage for d3qyja_ (3qyj A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871424Species Nostoc sp. [TaxId:103690] [256046] (1 PDB entry)
  8. 1871425Domain d3qyja_: 3qyj A: [249017]
    automated match to d4io0a_

Details for d3qyja_

PDB Entry: 3qyj (more details), 1.78 Å

PDB Description: Crystal structure of ALR0039, a putative alpha/beta hydrolase from Nostoc sp PCC 7120.
PDB Compounds: (A:) Alr0039 protein

SCOPe Domain Sequences for d3qyja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyja_ c.69.1.0 (A:) automated matches {Nostoc sp. [TaxId: 103690]}
mftnfeqtivdttearinlvkaghgapllllhgypqthvmwhkiapllannftvvatdlr
gygdssrpasvphhinyskrvmaqdqvevmsklgyeqfyvvghdrgarvahrlaldhphr
vkklalldiapthkmyrttdqefatayyhwffliqpdnlpetliganpeyylrkclekwg
kdfsafhpqalaeyircfsqpavihatcedyraaatidlehdeldmkqkiscpvlvlwge
kgiigrkydvlatwreraidvsgqslpcghflpeeapeetyqaiynflthc

SCOPe Domain Coordinates for d3qyja_:

Click to download the PDB-style file with coordinates for d3qyja_.
(The format of our PDB-style files is described here.)

Timeline for d3qyja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3qyjb_