SCOPe 2.06: Domain d3qvdg2: 3qvd G:135-171

Lineage for d3qvdg2 (3qvd G:135-171)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.0: automated matches [232942] (1 protein)
   not a true family

6. Protein automated matches [232943] (3 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)

8. Domain d3qvdg2: 3qvd G:135-171 [249014]
   Other proteins in same PDB: d3qvda1, d3qvdb1, d3qvdc1, d3qvdd1, d3qvde1, d3qvdf1, d3qvdg1, d3qvdh1
   automated match to d3mpsa2
   complexed with fe, fe2, peo

Details for d3qvdg2

PDB Entry: 3qvd, 2 Å

PDB Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.

PDB Compounds: (G:) rubrerythrin

SCOPe Domain Sequences for d3qvdg2:

Sequence; same for both SEQRES and ATOM records:

>d3qvdg2 g.41.5.0 (G:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

Timeline for d3qvdg2:

• d3qvdg2 first appeared in SCOPe 2.04
  
• d3qvdg2 appears in SCOPe 2.05
  
• d3qvdg2 appears in SCOPe 2.07
  
• d3qvdg2 appears in the current release, SCOPe 2.08