Lineage for d3qvde2 (3qvd E:135-171)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1706206Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 1706207Protein automated matches [232943] (2 species)
    not a true protein
  7. 1706221Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 1706230Domain d3qvde2: 3qvd E:135-171 [249010]
    Other proteins in same PDB: d3qvda1, d3qvdb1, d3qvdc1, d3qvdd1, d3qvde1, d3qvdf1, d3qvdg1, d3qvdh1
    automated match to d3mpsa2
    complexed with fe, fe2, peo

Details for d3qvde2

PDB Entry: 3qvd (more details), 2 Å

PDB Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.
PDB Compounds: (E:) rubrerythrin

SCOPe Domain Sequences for d3qvde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvde2 g.41.5.0 (E:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3qvde2:

Click to download the PDB-style file with coordinates for d3qvde2.
(The format of our PDB-style files is described here.)

Timeline for d3qvde2: