Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries) |
Domain d3qvdd1: 3qvd D:2-134 [249007] Other proteins in same PDB: d3qvda2, d3qvdb2, d3qvdc2, d3qvdd2, d3qvde2, d3qvdf2, d3qvdg2, d3qvdh2 automated match to d3mpsa1 complexed with fe, fe2, peo |
PDB Entry: 3qvd (more details), 2 Å
SCOPe Domain Sequences for d3qvdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvdd1 a.25.1.1 (D:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]} vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely rkakekaekgedi
Timeline for d3qvdd1: