![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.0: automated matches [232942] (1 protein) not a true family |
![]() | Protein automated matches [232943] (4 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries) |
![]() | Domain d3qvdc2: 3qvd C:135-171 [249006] Other proteins in same PDB: d3qvda1, d3qvdb1, d3qvdc1, d3qvdd1, d3qvde1, d3qvdf1, d3qvdg1, d3qvdh1 automated match to d3mpsa2 complexed with fe, fe2, peo |
PDB Entry: 3qvd (more details), 2 Å
SCOPe Domain Sequences for d3qvdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvdc2 g.41.5.0 (C:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]} eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d3qvdc2: